|
Customize a limit break only YOUR character could do - Printable Version +- Hydaelyn Role-Players (https://ffxiv-roleplayers.com/mybb18) +-- Forum: Community (https://ffxiv-roleplayers.com/mybb18/forumdisplay.php?fid=8) +--- Forum: RP Discussion (https://ffxiv-roleplayers.com/mybb18/forumdisplay.php?fid=13) +--- Thread: Customize a limit break only YOUR character could do (/showthread.php?tid=8218) Pages:
1
2
|
RE: Customize a limit break only YOUR character could do - OttoVann - 09-09-2014 Well...I'm a healer when I seriously play PvE, and a Dragoon when I am not so serious. The only thing I can think of, would be having more Chaos Thrust particle effects in my LimitBreaks since I wear that color seemingly more than the rest. Maybe since Otto has harems...lets see...to be honest this seems almost too hard. I dont roleplay combat ever, and don't have to since people know it would be foolish for several reasons to raise a hand to me. I'm too busy using my spear to chase skirts to actually pull a real one out and thrust it about. RE: Customize a limit break only YOUR character could do - Eva - 09-09-2014 We had a little fun with this, but not enough time to tailor them to specific levels and such, but I suppose these can be looked upon as the third tier for each, and probably shouldn't be taken too seriously (although these aren't nearly as goofy as what we came up with originally lol): Eva: WHM-Divine Embrace - The Priestess invokes the blessings of the Twelve upon the party.  Each member receives a temporary regen effect, a gradual MP replenishment, a gradual TP replenishment, and a boost to spell/skill speed.  Moreover the effects of Protect, Stoneskin, and Galvanize are augmented for the duration of the effect. DRG-Nymeia's Needle - The Priestess invokes the blessings of her matron deity, planting her weapon into the target enemy and calling upon her weapon to be used as a conduit of the divine.  The target is bound and suffers moderate damage and a moderate DoT for the duration of the effect.  Eva cannot attack further, and all party members are bound in place to the Spinner's Grand Design, but each gains a significant boost to HP and his or her primary stat for the duration of the effect. Blynbhar: WAR-Rightious Indignation - Blynbhar swings his axe at the ground before him.  Hellfire and brimstone erupt, causing powerful damage, enmity increase, and a strong DoT to all enemies as well as any allies unfortunate enough to be caught in a conal AoE in front of Blynbhar. RE: Customize a limit break only YOUR character could do - Val - 09-09-2014 (09-09-2014, 12:13 AM)Seriphyn Wrote: I am enjoying people's creative responses! I don't have a post though, since people know my approach to combat RP; Kale would very unlikely pull off anything remotely close to a Limit Break. HNNNNGHYESPLEASEMAKEITHAPPENMYFAVORITESERIESEVER except for maybe Legacy of Kain BUTHNGHPLZ RE: Customize a limit break only YOUR character could do - Oscare - 09-09-2014 I CAVED IN. All of these limit breaks make use of Oscare's axe, bow, and gun skill. Level 1: Zankusuken Fire twice with a gun, followed up immediately by a slash right through the target and firing an arrow from a back, charged with electricity and tremendous pushback power. Level 2: Furious Blitz Jump up in the air and empty out his quiver completely with a massive rain of arrows, diving down and landing on the enemy with his axe first and following up with a 22-hit blitz combining his axe and gun. Level 3: Thunderstorm Knock the enemy into the air with his axe and throwing the axe at the target like a tomahawk. While cleaved, Oscare empties out his pistol on the enemy and jumps up high into the air and delivers a electric charged set of arrows, raining down on the whole battle field. Special Instance Limit Break: Full-On Artillery Oscare unleashes this attack on a certain ~~BACKSTORY RELEVANT CHARACTER~~ that throws his axe at the enemy like a tomahawk, empties his pistols, launches two bombs, empties his quiver, fires twice with his rifle, and finishes off with a bang from a magnum shot. RE: Customize a limit break only YOUR character could do - CalebAgron - 09-14-2014 Caleb wouldn't be able to reach some of these limit breaks, at least not right now. But once he reaches his prime and learns to control aether a little better, his limit breaks might be seen as follows. Level 1- Gridanian Juggernaut! Caleb dashes forward using his shield as a battering ram, his shield would be laced with aether to give an extra umph when it hits. Level 2- Proud Defender! A quick dash to an ally raising his shield and creating a barrier between him and the enemy. His sword drops to allow his other hand to quickly provide a "jolt" of healing aether to the wounded ally. Level 3- Elementals Fury! He would raise his sword into the air gathering air aspect aether, causing Aero like winds to cut into all enemies around him. Once enough aether was gathered he would quickly strike the ground creating a tremor powerful enough to send enemies to the ground. RE: Customize a limit break only YOUR character could do - Marisa - 09-14-2014 Ryoko's limit break would be grabbing nearby lalafells and throwing them at the enemy. Higher ranks would throw fatter lalafells, and in greater quantities. RE: Customize a limit break only YOUR character could do - Meta Xi - 09-17-2014 I wish I had seen this thread sooner. I love making over the top Limit breaks! Level 1 - Heaven Fall Using the aether around him, Meta will burst forward in a powerful dash and pierce a target with his spear, transferring all his energy into the target and unleashing the gathered aether into an explosive force that harms the target and stunning them for a short time, while damaging nearby enemies for lesser damage and slowing them down. (The attack has a very high potency on the initial target and stuns them for 5 seconds. Nearby targets take only a small amount of damage, but are inflicted with heavy for 6 seconds.) Level 2 - Rhythm of the Earth Moving into the flow and pace of battle, Meta forces others to work at his pace and denies them control of the fight. (Enemies nearby by Meta are heavied and given paralysis. Meta cannot be bound, heavied, slowed, slept, knocked backed, or stunned during the duration of this Limit break.) Level 3 - 1000 Men, a Single Strike Meta let's the aether course through his whole being, letting it enhance all that he does as he strikes forward with a unstoppable barrage mirroring the might of an army. (Every buff has its bonuses doubled, and Life Surge's healing effect is applied to every attack Meta makes. Any time Meta makes an attack, the damage and effect dealt is applied to the target again a second after the initial strike. These effects last the duration of the LB.) RE: Customize a limit break only YOUR character could do - K'nahli - 09-17-2014 Level 1 - Hellfire (I don't know) K'nahli charges toward the enemy while unleashing several, quickly-shot arrows. Upon reaching close-proximity, she slides beneath the foe's legs to evade a naturally-responded melee attempt and closes with a powerful shot consisting of numerous arrows, aimed directly at the enemy's exposed back. For small, humanoid enemies, or other cases where this is anatomically impossible, K'nahli would launch herself over their head with a clean somersault and then conclude with the same back-shot. (If there are any really tall enemies that still can't be slid under then she... can tumble to the side and do a flank shot I guess). --------------------------------------------- Level 2 - Takedown (I don't know) K'nahli fires two arrows that impale the victim by the feet/lower shins to the floor and delivers a third shot to the upperbody that causes them to begin to fall over backward. From there, K'nahli quickly charges forward and launches herself onto the victim feet-first, slamming them into the ground where she concludes with a powerful shot aimed at their neck before withdrawing with a jump/backward somersault. On large or anatomically incorrect foes she would fire a flurry of shots that would cause a partial knockback - enough to gift her with an angle to land upon - and resume from there. For airborne foes she would resemble the above tactic but instead swing herself around to the back of it's neck after launching herself, and resume from there. --------------------------------------------- Level 3 - Daddy's Girl (I don't know) (Requires K'nahli to sustain at least one hit(melee included) before initiating). K'nahli is knocked backward into tumble/slide as a result of being hit. From there the enemy would have entered a sequence where it stops moving for a moment and simply observes. Gripping her arm as though wounded while still sitting on the ground, K'nahli should make some call that is typically seen from boss-raid dialogue that causes her father, K'yohko, to enter the scene and assist her with what is to come. From there they can both join to together to perform some more over-the-top archer and lancer moves that figuratively destroy the boss. Upon finishing, K'yohko could just throw in the old: "I must go, my people need me" dialogue before departing in.... I suppose an asian, gravity-defying styled leap. I'll let the rest of you decide at what point I became lazy with this. RE: Customize a limit break only YOUR character could do - Erik Mynhier - 09-17-2014 Level 1 - Knight's Code Like Cover on steroids, absorbs all damage to all party members for 15sec. Level 2 - Judgment Blade Single target damage with a potency of 300, and an AOE effect. Any allies in the AoE has their arggo reduced to zero, that arggo is absorbed by the skill user. More to a tank then defense, hate management is vital in some spots where hard hitting trash is overwhelming your control. Make the visual effect reminiscent of Stasis Sword from FFT. Level 3 - Knights of the Round Sultansworn of days gone by spring from the user in the form of aetheric ghost, one for every enemy on screen. Doing a potency 500 attack to each, absorbing any arggo the enemy has for any party member into the skill user. Come on, you know you miss KotR. RE: Customize a limit break only YOUR character could do - K'nahli - 09-17-2014 (09-17-2014, 01:51 PM)Erik Mynhier Wrote: Level 1 - Knight's Code I nearly spit up my drink because I read that as Clover(as in Clover Blake, the character in the screenshot in the spoiler). RE: Customize a limit break only YOUR character could do - CrookedTarot - 09-17-2014 This looks like fun! TAROT WANTS MAKE DO TOO! Level 1 Hugger-Mugger Tarot immediately loses all Aggro. Skill recharge time is reduced by 75% and every Physical attack he makes recovers 15% HP. Level 2 Break the Bank Tarot immediately loses all Aggro. Skill recharge time is reduced by 75% and Passives are reset. Every successful attack he makes recovers 15% HP. He also gains 2% of the damage dealt as Gil. Level 3 Crooked Phoenix Delivers an attack with a potency of 400 to all target enemies. All allies regain HP equal to the amount of damage dealt. KO'ed allies are revived and healed for 50% of the total damage dealt. RE: Customize a limit break only YOUR character could do - Jazz Egi - 09-17-2014 Tallera would use cheap pun versions of her standard spells as limit breaks. Although she's a huge coward and would probably flee before ever limit breaking at all. Level One: My Asthma: Tallera is so out of shape she can magically inflict her frailty upon others. All foes affected lose their next three spellcasts to rampant wheezing. Level Two: Sigho: Tallera's next Bio cast infuses the target with excessive apathy and broody angst. The target will spend its next six commands contemplating the futility of it all. Or writing dark poetry. Level Three: Ruin Everything: Tallera attempts to vanquish her foe but drops her grimoire instead. Hundreds of Ruin projectiles miss the target, forcing it to spend it's next ten attacks or spellcasts laughing at her. RE: Customize a limit break only YOUR character could do - Maia - 09-18-2014 I generally try to advertise Maia as a non-combatant (although she has more healing ability than she realizes at this point in her development), but I'll do this anyway!
RE: Customize a limit break only YOUR character could do - Ronin'ra - 09-18-2014 Ronin usually just wings it, so, here it goes: Level One The Bottle Ronin'ra removes a flask or something of the like from a pocket. Twisting free the cork, he downs a good portion in a singular gulp. Damage reduction is driven upward by 20%. He then hurls the container at whichever enemy is closest, increasing enmity and taunting it. Level Two Dirty Fighting Anything nearby is used as a weapon. Chairs, plates, sand, etcetera. With such gained armaments, his physical and ranged damage is increased by 20%. Dependent on the size of the object, it also has a 35% chance to stun the target. Increases enmity greatly. Level Three Ronin's Rampaging Elbow Driving his elbow towards the sky, he calls upon a short prayer to the Twelve. This Limit Break may only be used when completely hammered. Stumbling toward the opponent, he throws a quick elbow, scoring a battle cry amidst the attack. The target is stunned for 2 seconds, even on a miss. Then, bending down, the true attack lands, driving his fist into the enemies groin. The blow has a potency of 500 and knocks the target prone for 10 seconds. |