• Login
  • Register
Hello There, Guest!

Username:

Password:

Remember me

Lost PW Lost Password?

Advanced Search
  • Rules
  • Staff
  • Wiki
  • Free Companies
  • Linkshells
  • Calendar
  • Chat
  • Gallery
  • Donate
home Hydaelyn Role-Players → Community → RP Discussion v
« Previous 1 … 50 51 52 53 54 … 108 Next »
→

Customize a limit break only YOUR character could do


RPC has moved! These pages have been kept for historical purposes

Please be sure to visit https://ffxiv-roleplayers.com/ directly for the new page.


Customize a limit break only YOUR character could do
Threaded Mode | Linear Mode
Pages (2): « Previous 1 2

OttoVannv
OttoVann
Find all posts by this user
Posting Freak
*****

Offline
Posts:757
Joined:Jun 2014
Character:Otto Vann
Linkshell:Otto's Foxxy LS
Server:Balmung
Reputation: 125
RE: Customize a limit break only YOUR character could do |
#16
09-09-2014, 12:31 PM
Well...I'm a healer when I seriously play PvE, and a Dragoon when I am not so serious.

The only thing I can think of, would be having more Chaos Thrust particle effects in my LimitBreaks since I wear that color seemingly more than the rest.

Maybe since Otto has harems...lets see...to be honest this seems almost too hard. I dont roleplay combat ever, and don't have to since people know it would be foolish for several reasons to raise a hand to me. I'm too busy using my spear to chase skirts to actually pull a real one out and thrust it about.
Quote this message in a reply
Evav
Eva
Find all posts by this user
Visit this user's website
The Grey Priestess
*****

Offline
Posts:1,146
Joined:Mar 2010
Character:Eva Zelorius
Linkshell:Knights of Eorzea
Server:Balmung
Reputation: 66
RE: Customize a limit break only YOUR character could do |
#17
09-09-2014, 03:44 PM
We had a little fun with this, but not enough time to tailor them to specific levels and such, but I suppose these can be looked upon as the third tier for each, and probably shouldn't be taken too seriously (although these aren't nearly as goofy as what we came up with originally lol):


Eva:

WHM-Divine Embrace - The Priestess invokes the blessings of the Twelve upon the party.  Each member receives a temporary regen effect, a gradual MP replenishment, a gradual TP replenishment, and a boost to spell/skill speed.  Moreover the effects of Protect, Stoneskin, and Galvanize are augmented for the duration of the effect.

DRG-Nymeia's Needle - The Priestess invokes the blessings of her matron deity, planting her weapon into the target enemy and calling upon her weapon to be used as a conduit of the divine.  The target is bound and suffers moderate damage and a moderate DoT for the duration of the effect.  Eva cannot attack further, and all party members are bound in place to the Spinner's Grand Design, but each gains a significant boost to HP and his or her primary stat for the duration of the effect.


Blynbhar:

WAR-Rightious Indignation - Blynbhar swings his axe at the ground before him.  Hellfire and brimstone erupt, causing powerful damage, enmity increase, and a strong DoT to all enemies as well as any allies unfortunate enough to be caught in a conal AoE in front of Blynbhar.

"One of the deep secrets of life is that all that is really worth doing is what we do for others."  ~ Lewis Carol
Eva's Journals  |  Eva's Wiki Page (coming soon)  |  RP Handbook
Quote this message in a reply
Valv
Val
Find all posts by this user
Doxxing Since 1/25/16
*****

Offline
Posts:1,153
Joined:Aug 2013
Character:Val Nunh
Server:Balmung
Reputation: 245
RE: Customize a limit break only YOUR character could do |
#18
09-09-2014, 03:57 PM
(09-09-2014, 12:13 AM)Seriphyn Wrote: I am enjoying people's creative responses! I don't have a post though, since people know my approach to combat RP; Kale would very unlikely pull off anything remotely close to a Limit Break.

Man, if there was a gritty MMO akin to the Witcher universe...

HNNNNGHYESPLEASEMAKEITHAPPENMYFAVORITESERIESEVER

except for maybe Legacy of Kain

BUTHNGHPLZ

[Image: ValForumSignature.png~original]
Val Covington Wiki
Melfice Vainchelon Wiki
Cyrus Mulano Wiki
Quote this message in a reply
Oscarev
Oscare
Find all posts by this user
Hunter to be Hunted
****

Offline
Posts:712
Joined:Jun 2014
Character:Oscare Iono
Linkshell:Astral Agents
Server:Balmung
Reputation: 94
RE: Customize a limit break only YOUR character could do |
#19
09-09-2014, 04:07 PM
I CAVED IN. All of these limit breaks make use of Oscare's axe, bow, and gun skill.

Level 1: Zankusuken
Fire twice with a gun, followed up immediately by a slash right through the target and firing an arrow from a back, charged with electricity and tremendous pushback power.

Level 2: Furious Blitz
Jump up in the air and empty out his quiver completely with a massive rain of arrows, diving down and landing on the enemy with his axe first and following up with a 22-hit blitz combining his axe and gun.

Level 3: Thunderstorm
Knock the enemy into the air with his axe and throwing the axe at the target like a tomahawk. While cleaved, Oscare empties out his pistol on the enemy and jumps up high into the air and delivers a electric charged set of arrows, raining down on the whole battle field. 

Special Instance Limit Break: Full-On Artillery 
Oscare unleashes this attack on a certain ~~BACKSTORY RELEVANT CHARACTER~~ that throws his axe at the enemy like a tomahawk, empties his pistols, launches two bombs, empties his quiver, fires twice with his rifle, and finishes off with a bang from a magnum shot.

Oscare Iono (Directory)
Oscare Iono (Wiki WILL BE UPDATED EVENTUALLY)
[Image: embed?10297197]
"Critical fails; for when the GM sobs at night and the players get free checks."
Quote this message in a reply
CalebAgronv
CalebAgron
Find all posts by this user
Twin Adder Yellow Serpent
***

Offline
Posts:77
Joined:Sep 2013
Character:Caleb Agron
Server:Balmung
Reputation: 7
RE: Customize a limit break only YOUR character could do |
#20
09-14-2014, 01:10 AM
Caleb wouldn't be able to reach some of these limit breaks, at least not right now. But once he reaches his prime and learns to control aether a little better, his limit breaks might be seen as follows.

Level 1- Gridanian Juggernaut!
Caleb dashes forward using his shield as a battering ram, his shield would be laced with aether to give an extra umph when it hits.

Level 2- Proud Defender!
A quick dash to an ally raising his shield and creating a barrier between him and the enemy. His sword drops to allow his other hand to quickly provide a "jolt" of healing aether to the wounded ally.

Level 3- Elementals Fury!
He would raise his sword into the air gathering air aspect aether, causing Aero like winds to cut into all enemies around him. Once enough aether was gathered he would quickly strike the ground creating a tremor powerful enough to send enemies to the ground.
Quote this message in a reply
Marisav
Marisa
Find all posts by this user
Senior Member
****

Offline
Posts:432
Joined:Aug 2014
Character:Marisa Stormsong
Linkshell:Ishgard RP
Server:Balmung
Reputation: 51
RE: Customize a limit break only YOUR character could do |
#21
09-14-2014, 01:36 AM
Ryoko's limit break would be grabbing nearby lalafells and throwing them at the enemy. Higher ranks would throw fatter lalafells, and in greater quantities.
Quote this message in a reply
Meta Xiv
Meta Xi
Find all posts by this user
Junior Member
**

Offline
Posts:34
Joined:Jul 2014
Character:Meta Xi
Server:Balmung
Reputation: 3
RE: Customize a limit break only YOUR character could do |
#22
09-17-2014, 10:56 AM
I wish I had seen this thread sooner. I love making over the top Limit breaks!

Level 1 - Heaven Fall
Using the aether around him, Meta will burst forward in a powerful dash and pierce a target with his spear, transferring all his energy into the target and unleashing the gathered aether into an explosive force that harms the target and stunning them for a short time, while damaging nearby enemies for lesser damage and slowing them down.
(The attack has a very high potency on the initial target and stuns them for 5 seconds. Nearby targets take only a small amount of damage, but are inflicted with heavy for 6 seconds.)

Level 2 - Rhythm of the Earth
Moving into the flow and pace of battle, Meta forces others to work at his pace and denies them control of the fight.
(Enemies nearby by Meta are heavied and given paralysis. Meta cannot be bound, heavied, slowed, slept, knocked backed, or stunned during the duration of this Limit break.)

Level 3 - 1000 Men, a Single Strike
Meta let's the aether course through his whole being, letting it enhance all that he does as he strikes forward with a unstoppable barrage mirroring the might of an army.
(Every buff has its bonuses doubled, and Life Surge's healing effect is applied to every attack Meta makes. Any time Meta makes an attack, the damage and effect dealt is applied to the target again a second after the initial strike. These effects last the duration of the LB.)

The slowly updated wiki of Meta.
Quote this message in a reply
K'nahliv
K'nahli
Find all posts by this user
Visit this user's website
Young Huntress
*****

Offline
Posts:1,616
Joined:Jul 2013
Character:K'nahli
Server:Balmung
Reputation: 132
RE: Customize a limit break only YOUR character could do |
#23
09-17-2014, 12:07 PM
(This post was last modified: 09-17-2014, 12:13 PM by K'nahli.)
Level 1 - Hellfire (I don't know)

K'nahli charges toward the enemy while unleashing several, quickly-shot arrows. Upon reaching close-proximity, she slides beneath the foe's legs to evade a naturally-responded melee attempt and closes with a powerful shot consisting of numerous arrows, aimed directly at the enemy's exposed back.


For small, humanoid enemies, or other cases where this is anatomically impossible, K'nahli would launch herself over their head with a clean somersault and then conclude with the same back-shot.

(If there are any really tall enemies that still can't be slid under then she... can tumble to the side and do a flank shot I guess).


---------------------------------------------


Level 2 - Takedown (I don't know)

K'nahli fires two arrows that impale the victim by the feet/lower shins to the floor and delivers a third shot to the upperbody that causes them to begin to fall over backward. From there, K'nahli quickly charges forward and launches herself onto the victim feet-first, slamming them into the ground where she concludes with a powerful shot aimed at their neck before withdrawing with a jump/backward somersault.


On large or anatomically incorrect foes she would fire a flurry of shots that would cause a partial knockback - enough to gift her with an angle to land upon - and resume from there.


For airborne foes she would resemble the above tactic but instead swing herself around to the back of it's neck after launching herself, and resume from there.


---------------------------------------------


Level 3 - Daddy's Girl (I don't know)

(Requires K'nahli to sustain at least one hit(melee included) before initiating).


K'nahli is knocked backward into tumble/slide as a result of being hit. From there the enemy would have entered a sequence where it stops moving for a moment and simply observes. Gripping her arm as though wounded while still sitting on the ground, K'nahli should make some call that is typically seen from boss-raid dialogue that causes her father, K'yohko, to enter the scene and assist her with what is to come.


From there they can both join to together to perform some more over-the-top archer and lancer moves that figuratively destroy the boss. Upon finishing, K'yohko could just throw in the old:  "I must go, my people need me" dialogue before departing in.... I suppose an asian, gravity-defying styled leap.




I'll let the rest of you decide at what point I became lazy with this.



Show Content
Spoiler
I really, really dislike over-the-top fighting styles like you see in Limit Breaks(in the case of actual RP) so all of this is purely humourous even if my examples aren't quite as bad as they could be, (minus some of the jumping, of course!).

[Image: ecec20e41f.png]
Characters: Andre Winter (Hy'ur) / K'nahli Yohko (Miqo'te)
Quote this message in a reply
Erik Mynhierv
Erik Mynhier
Find all posts by this user
Visit this user's website
Captain of the Red Wings
*****

Offline
Posts:1,587
Joined:Aug 2013
Character:Erik Mynhier
Linkshell:The Red Wings
Server:Balmung
Reputation: 154
RE: Customize a limit break only YOUR character could do |
#24
09-17-2014, 01:51 PM
Level 1 - Knight's Code

Like Cover on steroids, absorbs all damage to all party members for 15sec.


Level 2 - Judgment Blade

Single target damage with a potency of 300, and an AOE effect. Any allies in the AoE has their arggo reduced to zero, that arggo is absorbed by the skill user. More to a tank then defense, hate management is vital in some spots where hard hitting trash is overwhelming your control. Make the visual effect reminiscent of Stasis Sword from FFT.


Level 3 - Knights of the Round

Sultansworn of days gone by spring from the user in the form of aetheric ghost, one for every enemy on screen. Doing a potency 500 attack to each, absorbing any arggo the enemy has for any party member into the skill user. Come on, you know you miss KotR.

The Red Wings
[Image: Emblem%252520by%252520Rhea%252520Zaheela%252520x50.png]
~By Fire Reborn~
Signature by Rhea Zaheela
See Our Official Website For More Details
Quote this message in a reply
K'nahliv
K'nahli
Find all posts by this user
Visit this user's website
Young Huntress
*****

Offline
Posts:1,616
Joined:Jul 2013
Character:K'nahli
Server:Balmung
Reputation: 132
RE: Customize a limit break only YOUR character could do |
#25
09-17-2014, 02:41 PM
(09-17-2014, 01:51 PM)Erik Mynhier Wrote: Level 1 - Knight's Code

Like Cover on steroids, absorbs all damage to all party members for 15sec.

I nearly spit up my drink because I read that as Clover(as in Clover Blake, the character in the screenshot in the spoiler).


Show Content
Spoiler[Image: tumblr_naijnkog5f1sa36iko2_r1_1280.jpg]

For health and safety reasons(referring to me only), I cannot represent this in Photoshop format.

[Image: ecec20e41f.png]
Characters: Andre Winter (Hy'ur) / K'nahli Yohko (Miqo'te)
Quote this message in a reply
CrookedTarotv
CrookedTarot
Find all posts by this user
Dealer of Fate
***

Offline
Posts:176
Joined:Aug 2014
Character:Crooked Tarot
Linkshell:Astral Agents
Server:Balmung
Reputation: 29
RE: Customize a limit break only YOUR character could do |
#26
09-17-2014, 03:58 PM
This looks like fun! TAROT WANTS MAKE DO TOO!

Level 1

Hugger-Mugger

Tarot immediately loses all Aggro. Skill recharge time is reduced by 75% and every Physical attack he makes recovers 15% HP.

Level 2


Break the Bank

Tarot immediately loses all Aggro. Skill recharge time is reduced by 75% and Passives are reset. Every successful attack he makes recovers 15% HP. He also gains 2% of the damage dealt as Gil.

Level 3


Crooked Phoenix

Delivers an attack with a potency of 400 to all target enemies. All allies regain HP equal to the amount of damage dealt. KO'ed allies are revived and healed for 50% of the total damage dealt.

[Image: tumblr_na3nykiJYw1tj8x6po1_400.jpg]
Crooked Tarot's Wiki
Quote this message in a reply
Jazz Egiv
Jazz Egi
Find all posts by this user
Member
***

Offline
Posts:68
Joined:Sep 2014
Character:Tallera Weaver
Server:Balmung
Reputation: 6
RE: Customize a limit break only YOUR character could do |
#27
09-17-2014, 07:39 PM
(This post was last modified: 09-17-2014, 07:40 PM by Jazz Egi.)
Tallera would use cheap pun versions of her standard spells as limit breaks. Although she's a huge coward and would probably flee before ever limit breaking at all.

Level One:

My Asthma: Tallera is so out of shape she can magically inflict her frailty upon others. All foes affected lose their next three spellcasts to rampant wheezing.

Level Two:

Sigho: Tallera's next Bio cast infuses the target with excessive apathy and broody angst. The target will spend its next six commands contemplating the futility of it all. Or writing dark poetry.

Level Three:

Ruin Everything: Tallera attempts to vanquish her foe but drops her grimoire instead. Hundreds of Ruin projectiles miss the target, forcing it to spend it's next ten attacks or spellcasts laughing at her.
Quote this message in a reply
Maiav
Maia
Find all posts by this user
The Least Star
****

Offline
Posts:465
Joined:Mar 2014
Character:D'ranmaia Shenn
Linkshell:Rendezvous of Stars
Server:Balmung
Reputation: 67
RE: Customize a limit break only YOUR character could do |
#28
09-18-2014, 08:53 AM
(This post was last modified: 09-18-2014, 08:55 AM by Maia.)
I generally try to advertise Maia as a non-combatant (although she has more healing ability than she realizes at this point in her development), but I'll do this anyway!
  • I - Blind Panic
Maia gets so worked up that her evasion shoots up to 100%, her flailing and panicking reaching such a height as to confuse the enemy. When anything physical tries to hit her, she will either duck with arms waving, trip, squeak and fall backward, or otherwise move in an erratic way that manages to avoid the attack.
  • II - Blind Faith
Maia begins chanting a longer-than-usual spell, although it looks more like desperate, flinch-praying than anything. Her tail frizzes out and her ears fold back, and a protective shield bends around the entire party, cutting all damage by 50% for the duration of the ability. After casting, a quick word bubble comes up saying, "Ah, um, did I do it...?"
  • III - Blind Trust
Maia reaches such a point of desperation that she slowly shuffles forward to confront the enemy directly. After fumbling with her cane, untrained arms swing her staff to bonk the opponent, but at the last minute another member of Rendezvous teleports in and thwacks the enemy for critical damage. Afterward, she looks tentatively pleased with her contribution.
Quote this message in a reply
Ronin'rav
Ronin'ra
Find all posts by this user
Probably
***

Offline
Posts:50
Joined:Sep 2014
Character:Ronin'ra Jinehga
Server:Balmung
Reputation: 6
RE: Customize a limit break only YOUR character could do |
#29
09-18-2014, 10:49 AM
(This post was last modified: 09-18-2014, 10:50 AM by Ronin'ra.)
Ronin usually just wings it, so, here it goes:

Level One


The Bottle


Ronin'ra removes a flask or something of the like from a pocket. Twisting free the cork, he downs a good portion in a singular gulp. Damage reduction is driven upward by 20%. He then hurls the container at whichever enemy is closest, increasing enmity and taunting it.


Level Two


Dirty Fighting


Anything nearby is used as a weapon. Chairs, plates, sand, etcetera. With such gained armaments, his physical and ranged damage is increased by 20%. Dependent on the size of the object, it also has a 35% chance to stun the target. Increases enmity greatly.


Level Three


Ronin's Rampaging Elbow


Driving his elbow towards the sky, he calls upon a short prayer to the Twelve. This Limit Break may only be used when completely hammered. Stumbling toward the opponent, he throws a quick elbow, scoring a battle cry amidst the attack. The target is stunned for 2 seconds, even on a miss. Then, bending down, the true attack lands, driving his fist into the enemies groin. The blow has a potency of 500 and knocks the target prone for 10 seconds.
Quote this message in a reply

« Next Oldest | Next Newest »
Pages (2): « Previous 1 2

  • View a Printable Version
  • Send this Thread to a Friend
  • Subscribe to this thread


Users browsing this thread: 2 Guest(s)
Index | Return to Top | Lite (Archive) Mode | RSS Syndication | Current time: 06-15-2026, 07:26 PM

Final Fantasy XIV images/content © Square-Enix, forum content © RPC.
The RPC is not affiliated with Square-Enix or any of its subsidiaries.
Powered By MyBB, © 2002-2026 MyBB Group.
Designed by Adrian/Reksio, modified by Kylin@RPC